Gematria Calculation Result for mining on Simple Gematria
The phrase "mining" has a gematria value of 66 using the Simple Gematria system.
This is calculated by summing each letter's value: m(13) + i(9) + n(14) + i(9) + n(14) + g(7).
mining in other Gematria Types:
English Gematria:396
Simple Gematria:66
Jewish Gematria:135
Rabbis (Mispar Gadol):165
Reversed Reduced Gematria:33
Hebrew English Gematria:165
Reduced Gematria:39
Reversed Simple Gematria:96
Reversed English Gematria:576
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:1002
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:276
Reverse Satanic:306
Primes Gematria:190
Reverse Primes:318
Trigonal Gematria:419
Reverse Trigonal:839
Squares Gematria:772
Reverse Squares:1582
Chaldean Numerology:19
Septenary Gematria:20
Single Reduction:39
Full Reduction KV:39
Single Reduction KV:39
Reverse Single Reduction:33
Reverse Full Reduction EP:33
Reverse Single Reduction EP:33
Reverse Extended:510
Jewish Reduction:36
Jewish Ordinal:63
ALW Kabbalah:106
KFW Kabbalah:114
LCH Kabbalah:80
Fibonacci Sequence:780
Keypad Gematria:30
Matching Word Cloud (Value: 66)
abraxasabyssaddendumancientanubisbackdatesblessedbundycatfishcharlesclassiccoreycoronacursedenmarkdialecticenvyeventfamilyfiftyfreedomgrapeshappyjessicalinkablelostlululyonmanuelmolochmortmythonlypixelplannedpopspumpqueerrubyrushseerssinglesnuffsugarthuletimestwinuponweddingwoman
View more matches for 66→"mining" stat:
Source: Word Database
Legal rate: 381
Rank: 672
