Gematria Calculation Result for curse on Simple Gematria
The phrase "curse" has a gematria value of 66 using the Simple Gematria system.
This is calculated by summing each letter's value: c(3) + u(21) + r(18) + s(19) + e(5).
curse in other Gematria Types:
English Gematria:396
Simple Gematria:66
Jewish Gematria:378
Rabbis (Mispar Gadol):498
Reversed Reduced Gematria:33
Hebrew English Gematria:514
Reduced Gematria:21
Reversed Simple Gematria:69
Reversed English Gematria:414
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:105
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:241
Reverse Satanic:244
Primes Gematria:217
Reverse Primes:223
Trigonal Gematria:613
Reverse Trigonal:655
Squares Gematria:1160
Reverse Squares:1241
Chaldean Numerology:19
Septenary Gematria:25
Single Reduction:30
Full Reduction KV:21
Single Reduction KV:30
Reverse Single Reduction:33
Reverse Full Reduction EP:51
Reverse Single Reduction EP:51
Reverse Extended:1023
Jewish Reduction:27
Jewish Ordinal:63
ALW Kabbalah:72
KFW Kabbalah:80
LCH Kabbalah:69
Fibonacci Sequence:70
Keypad Gematria:27
Matching Word Cloud (Value: 66)
abraxasabyssaddendumancientanubisbackdatesblessedbundycatfishcharlesclassiccoreycoronacursedenmarkdialecticenvyeventfamilyfiftyfreedomgrapeshappyjessicalinkablelostlululyonmanuelmolochmortmythonlypixelplannedpopspumpqueerrubyrushseerssinglesnuffsugarthuletimestwinuponweddingwoman
View more matches for 66→"curse" stat:
Source: Word Database
Legal rate: 454
Rank: 2864