Gematria Calculation Result for impis on Simple Gematria
The phrase "impis" has a gematria value of 66 using the Simple Gematria system.
This is calculated by summing each letter's value: i(9) + m(13) + p(16) + i(9) + s(19).
impis in other Gematria Types:
English Gematria:396
Simple Gematria:66
Jewish Gematria:198
Rabbis (Mispar Gadol):228
Reversed Reduced Gematria:33
Hebrew English Gematria:428
Reduced Gematria:30
Reversed Simple Gematria:69
Reversed English Gematria:414
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:1002
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:241
Reverse Satanic:244
Primes Gematria:207
Reverse Primes:215
Trigonal Gematria:507
Reverse Trigonal:549
Squares Gematria:948
Reverse Squares:1029
Chaldean Numerology:17
Septenary Gematria:20
Single Reduction:39
Full Reduction KV:30
Single Reduction KV:39
Reverse Single Reduction:33
Reverse Full Reduction EP:42
Reverse Single Reduction EP:42
Reverse Extended:258
Jewish Reduction:36
Jewish Ordinal:63
ALW Kabbalah:98
KFW Kabbalah:98
LCH Kabbalah:40
Fibonacci Sequence:411
Keypad Gematria:28
Matching Word Cloud (Value: 66)
ablatingabraxasabyssaddendumancientanubisbackdatesblessedbundycatfishcharlesclassiccoreycoronacursedenmarkdialecticeventfamilyfiftyfreedomgrapeshappyjessicalinkablelostlululyonmanuelmolochonlypixelplannedpopspumpqueerrubyrushsampleseerssinglesnuffsugarthuletimestwintypeuponweddingwoman
View more matches for 66→"impis" stat:
Source: Word Database
Legal rate: 82
Rank:
