Gematria Calculation Result for edison on Simple Gematria
The phrase "edison" has a gematria value of 66 using the Simple Gematria system.
This is calculated by summing each letter's value: e(5) + d(4) + i(9) + s(19) + o(15) + n(14).
edison in other Gematria Types:
English Gematria:396
Simple Gematria:66
Jewish Gematria:198
Rabbis (Mispar Gadol):228
Reversed Reduced Gematria:33
Hebrew English Gematria:428
Reduced Gematria:30
Reversed Simple Gematria:96
Reversed English Gematria:576
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:501
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:276
Reverse Satanic:306
Primes Gematria:198
Reverse Primes:320
Trigonal Gematria:485
Reverse Trigonal:905
Squares Gematria:904
Reverse Squares:1714
Chaldean Numerology:25
Septenary Gematria:23
Single Reduction:39
Full Reduction KV:30
Single Reduction KV:39
Reverse Single Reduction:33
Reverse Full Reduction EP:51
Reverse Single Reduction EP:51
Reverse Extended:1068
Jewish Reduction:36
Jewish Ordinal:63
ALW Kabbalah:80
KFW Kabbalah:104
LCH Kabbalah:85
Fibonacci Sequence:440
Keypad Gematria:29
Matching Word Cloud (Value: 66)
abraxasabyssaddendumancientanubisbackdatesblessedbundycatfishcharlesclassiccoreycoronacursedenmarkdialecticenvyeventfamilyfiftyfreedomgrapeshappyjessicalinkablelostlululyonmanuelmolochmortmythonlypixelplannedpopspumpqueerrubyrushseerssinglesnuffsugarthuletimestwinuponweddingwoman
View more matches for 66→"edison" stat:
Source: Word Database
Legal rate: 247
Rank: 863
