Gematria Calculation Result for beasts on Simple Gematria
The phrase "beasts" has a gematria value of 66 using the Simple Gematria system.
This is calculated by summing each letter's value: b(2) + e(5) + a(1) + s(19) + t(20) + s(19).
beasts in other Gematria Types:
English Gematria:396
Simple Gematria:66
Jewish Gematria:288
Rabbis (Mispar Gadol):408
Reversed Reduced Gematria:42
Hebrew English Gematria:1008
Reduced Gematria:12
Reversed Simple Gematria:96
Reversed English Gematria:576
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:0
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:276
Reverse Satanic:306
Primes Gematria:221
Reverse Primes:332
Trigonal Gematria:609
Reverse Trigonal:1029
Squares Gematria:1152
Reverse Squares:1962
Chaldean Numerology:18
Septenary Gematria:27
Single Reduction:30
Full Reduction KV:12
Single Reduction KV:30
Reverse Single Reduction:42
Reverse Full Reduction EP:60
Reverse Single Reduction EP:60
Reverse Extended:1923
Jewish Reduction:27
Jewish Ordinal:63
ALW Kabbalah:80
KFW Kabbalah:96
LCH Kabbalah:77
Fibonacci Sequence:62
Keypad Gematria:29
Matching Word Cloud (Value: 66)
abraxasabyssaddendumancientanubisblessedbundycardboardcatfishcharlesclassiccoreycoronacursedenmarkdialecticenvyeventfamilyfiftyfreedomgrapeshappyjeromejessicalinkablelostlululyonmankindmanuelmolochmortmythonlypixelpumpqueerrubyrushseerssnuffsugarthuletimestobiastwinuponweddingwoman
View more matches for 66→"beasts" stat:
Source: Word Database
Legal rate: 240
Rank: 786
