Gematria Calculation Result for ankus on Simple Gematria
The phrase "ankus" has a gematria value of 66 using the Simple Gematria system.
This is calculated by summing each letter's value: a(1) + n(14) + k(11) + u(21) + s(19).
ankus in other Gematria Types:
English Gematria:396
Simple Gematria:66
Jewish Gematria:341
Rabbis (Mispar Gadol):471
Reversed Reduced Gematria:33
Hebrew English Gematria:377
Reduced Gematria:12
Reversed Simple Gematria:69
Reversed English Gematria:414
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:5
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:241
Reverse Satanic:244
Primes Gematria:216
Reverse Primes:227
Trigonal Gematria:593
Reverse Trigonal:635
Squares Gematria:1120
Reverse Squares:1201
Chaldean Numerology:17
Septenary Gematria:17
Single Reduction:21
Full Reduction KV:21
Single Reduction KV:30
Reverse Single Reduction:33
Reverse Full Reduction EP:33
Reverse Single Reduction EP:33
Reverse Extended:924
Jewish Reduction:17
Jewish Ordinal:62
ALW Kabbalah:46
KFW Kabbalah:78
LCH Kabbalah:86
Fibonacci Sequence:352
Keypad Gematria:28
Matching Word Cloud (Value: 66)
abraxasabyssaddendumancientanubisbackdatesblessedbundycatfishcharlesclassiccoreycoronacursedenmarkdialecticenvyeventfamilyfiftyfreedomgrapeshappyjessicalinkablelostlululyonmanuelmolochmythonlypixelplannedpopspumpqueerrubyrushsampleseerssinglesnuffsugarthuletimestwinuponweddingwoman
View more matches for 66→"ankus" stat:
Source: Word Database
Legal rate: 219
Rank:
