Gematria Calculation Result for axis on Trigonal Gematria
The phrase "axis" has a gematria value of 536 using the Trigonal Gematria system.
This is calculated by summing each letter's value: a(1) + x(300) + i(45) + s(190).
axis in other Gematria Types:
English Gematria:318
Simple Gematria:53
Jewish Gematria:400
Rabbis (Mispar Gadol):710
Reversed Reduced Gematria:28
Hebrew English Gematria:400
Reduced Gematria:17
Reversed Simple Gematria:55
Reversed English Gematria:330
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:11
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:193
Reverse Satanic:195
Primes Gematria:181
Reverse Primes:186
Trigonal Gematria:536
Reverse Trigonal:564
Squares Gematria:1019
Reverse Squares:1073
Chaldean Numerology:10
Septenary Gematria:15
Single Reduction:26
Full Reduction KV:17
Single Reduction KV:26
Reverse Single Reduction:28
Reverse Full Reduction EP:28
Reverse Single Reduction EP:28
Reverse Extended:901
Jewish Reduction:22
Jewish Ordinal:49
ALW Kabbalah:51
KFW Kabbalah:67
LCH Kabbalah:26
Fibonacci Sequence:58
Keypad Gematria:22
Matching Word Cloud (Value: 536)
accloyaccompaniedaccrescenceadaptingaffirmeragaricalesairchecksajointambriteamidatingamzelanchorableantibankaotesaphelionarchmagicianarticledaxisbackspangbludgercapouchchannelsdaedalusdecisiondorisemanuelessencegibberishharakirihughesironcladjewslogoslumpmazelmistmoosemoypicklesplumpricingpstptsqatarrivkaspttaytpstspyom
View more matches for 536→"axis" stat:
Source: Word Database
Legal rate: 641
Rank: 1262
