Gematria Calculation Result for refract on Reverse Single Reduction EP
The phrase "refract" has a gematria value of 64 using the Reverse Single Reduction EP system.
This is calculated by summing each letter's value: r(9) + e(22) + f(3) + r(9) + a(8) + c(6) + t(7).
refract in other Gematria Types:
English Gematria:426
Simple Gematria:71
Jewish Gematria:275
Rabbis (Mispar Gadol):395
Reversed Reduced Gematria:46
Hebrew English Gematria:815
Reduced Gematria:35
Reversed Simple Gematria:118
Reversed English Gematria:708
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:100
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:316
Reverse Satanic:363
Primes Gematria:224
Reverse Primes:405
Trigonal Gematria:595
Reverse Trigonal:1253
Squares Gematria:1119
Reverse Squares:2388
Chaldean Numerology:25
Septenary Gematria:32
Single Reduction:35
Full Reduction KV:35
Single Reduction KV:35
Reverse Single Reduction:46
Reverse Full Reduction EP:64
Reverse Single Reduction EP:64
Reverse Extended:2125
Jewish Reduction:32
Jewish Ordinal:68
ALW Kabbalah:105
KFW Kabbalah:57
LCH Kabbalah:69
Fibonacci Sequence:97
Keypad Gematria:32
Matching Word Cloud (Value: 64)
adjoinedamnesiaandreasangarepapinagearchieatomizationayahuascabackbonebonchiefcaptivitycassandracelticschickenchoicesconditionalcovfefecreatorcurrencydeborahdeutschenterexistinghandlerhelenhestiainformationintroducingjasminejustineleopardmachinemushroomingnatalienicotinenumbnessobfuscationoedipuspalladiumpiscesplaygroundspowerfulreligionsoftwarespiderstevesuccessvalidationwesleywheel
View more matches for 64→"refract" stat:
Source: Word Database
Legal rate: 236
Rank: 412
