Gematria Calculation Result for captious on Reverse Satanic
The phrase "captious" has a gematria value of 392 using the Reverse Satanic system.
This is calculated by summing each letter's value: c(59) + a(61) + p(46) + t(42) + i(53) + o(47) + u(41) + s(43).
captious in other Gematria Types:
English Gematria:624
Simple Gematria:104
Jewish Gematria:513
Rabbis (Mispar Gadol):743
Reversed Reduced Gematria:49
Hebrew English Gematria:849
Reduced Gematria:32
Reversed Simple Gematria:112
Reversed English Gematria:672
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:106
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:384
Reverse Satanic:392
Primes Gematria:341
Reverse Primes:368
Trigonal Gematria:939
Reverse Trigonal:1051
Squares Gematria:1774
Reverse Squares:1990
Chaldean Numerology:33
Septenary Gematria:33
Single Reduction:41
Full Reduction KV:32
Single Reduction KV:41
Reverse Single Reduction:49
Reverse Full Reduction EP:58
Reverse Single Reduction EP:58
Reverse Extended:1561
Jewish Reduction:36
Jewish Ordinal:99
ALW Kabbalah:116
KFW Kabbalah:140
LCH Kabbalah:70
Fibonacci Sequence:312
Keypad Gematria:44
Matching Word Cloud (Value: 392)
accingeacclaimacronomyadinidaafdechoapneusisasterismattaintsautopsicbabblerbeadingblotlessboltlesscaptiousceciliacesspoolconjurercrossingdefencedevotiondrowningforewordfourteenftftftftgovcoinsidolatryimperiumimplantsinductorjunkyardneomorphnormandyobserverordinaryoutatimeoverseasreptilesrestoredrhythmicshoppingsprinklestarlinksterlingsubsumedsubtractsuddenlytemplarsvariantswhatsappxenogamy
View more matches for 392→"captious" stat:
Source: Word Database
Legal rate: 277
Rank:
