Gematria Calculation Result for pyroxene on Reverse Primes
The phrase "pyroxene" has a gematria value of 298 using the Reverse Primes system.
This is calculated by summing each letter's value: p(31) + y(3) + r(23) + o(37) + x(5) + e(79) + n(41) + e(79).
pyroxene in other Gematria Types:
English Gematria:732
Simple Gematria:122
Jewish Gematria:940
Rabbis (Mispar Gadol):1580
Reversed Reduced Gematria:31
Hebrew English Gematria:490
Reduced Gematria:50
Reversed Simple Gematria:94
Reversed English Gematria:564
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:10
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:402
Reverse Satanic:374
Primes Gematria:412
Reverse Primes:298
Trigonal Gematria:1187
Reverse Trigonal:795
Squares Gematria:2252
Reverse Squares:1496
Chaldean Numerology:38
Septenary Gematria:26
Single Reduction:50
Full Reduction KV:50
Single Reduction KV:50
Reverse Single Reduction:31
Reverse Full Reduction EP:76
Reverse Single Reduction EP:76
Reverse Extended:904
Jewish Reduction:40
Jewish Ordinal:112
ALW Kabbalah:146
KFW Kabbalah:122
LCH Kabbalah:102
Fibonacci Sequence:513
Keypad Gematria:50
Matching Word Cloud (Value: 298)
abbyafarafraanointarcturusaroundaspishauroraautotypebabybalkbestrowsbldgbummercalichancleddecldikadisunitydrivenectypeegaleightyfandfeffgaelgaleieeekaidkamalongermoonshotnobodyoffsetphilippiscesrocketschismshilohspherethanksthe keytraitorstraumavikingwalletwheelswhiteoutzealous
View more matches for 298→"pyroxene" stat:
Source: Word Database
Legal rate: 91
Rank:
