Gematria Calculation Result for arcturus on Reverse Primes
The phrase "arcturus" has a gematria value of 298 using the Reverse Primes system.
This is calculated by summing each letter's value: a(101) + r(23) + c(89) + t(17) + u(13) + r(23) + u(13) + s(19).
arcturus in other Gematria Types:
English Gematria:726
Simple Gematria:121
Jewish Gematria:754
Rabbis (Mispar Gadol):1084
Reversed Reduced Gematria:59
Hebrew English Gematria:1116
Reduced Gematria:31
Reversed Simple Gematria:95
Reversed English Gematria:570
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:110
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:401
Reverse Satanic:375
Primes Gematria:413
Reverse Primes:298
Trigonal Gematria:1211
Reverse Trigonal:847
Squares Gematria:2301
Reverse Squares:1599
Chaldean Numerology:27
Septenary Gematria:39
Single Reduction:40
Full Reduction KV:31
Single Reduction KV:40
Reverse Single Reduction:59
Reverse Full Reduction EP:59
Reverse Single Reduction EP:59
Reverse Extended:1445
Jewish Reduction:34
Jewish Ordinal:115
ALW Kabbalah:101
KFW Kabbalah:109
LCH Kabbalah:109
Fibonacci Sequence:121
Keypad Gematria:49
Matching Word Cloud (Value: 298)
abbyafarafraanointarcturusaroundaspishauroraautotypeazoniumbabybalkbldgbummercalichancleddecldikadisunitydrivenectypeegaleightyfeffgaelgaleieeekaidkamamoonshotnobodyoffsetphilippiscesrocketschismshilohspherestackssynchrosthanksthe keytraitorstraumavikingwalletwheelswhiteoutzealous
View more matches for 298→"arcturus" stat:
Source: Word Database
Legal rate: 457
Rank: 4427
