Gematria Calculation Result for abridging on Reverse Full Reduction EP
The phrase "abridging" has a gematria value of 55 using the Reverse Full Reduction EP system.
This is calculated by summing each letter's value: a(8) + b(7) + r(9) + i(9) + d(5) + g(2) + i(9) + n(4) + g(2).
abridging in other Gematria Types:
English Gematria:426
Simple Gematria:71
Jewish Gematria:159
Rabbis (Mispar Gadol):179
Reversed Reduced Gematria:55
Hebrew English Gematria:289
Reduced Gematria:53
Reversed Simple Gematria:172
Reversed English Gematria:1032
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:502
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:386
Reverse Satanic:487
Primes Gematria:196
Reverse Primes:609
Trigonal Gematria:436
Reverse Trigonal:1850
Squares Gematria:801
Reverse Squares:3528
Chaldean Numerology:22
Septenary Gematria:37
Single Reduction:53
Full Reduction KV:53
Single Reduction KV:53
Reverse Single Reduction:55
Reverse Full Reduction EP:55
Reverse Single Reduction EP:55
Reverse Extended:2629
Jewish Reduction:51
Jewish Ordinal:69
ALW Kabbalah:121
KFW Kabbalah:145
LCH Kabbalah:108
Fibonacci Sequence:366
Keypad Gematria:36
Matching Word Cloud (Value: 55)
cancerabrasingansweranxietyaquariusarchieayahuascabeenbonchiefbrendabulgariaburgercancercapitalcardinalchickenchoicesconstantlydeborahdeutschenemyerikafibonacciflowershandlerhelenhestiaistanbulkilledladdermachinemarvelmerlinmysterypausequeenrumblesamuelslipknotspacestoicismsummersunsetsupporttargetunrealvirginiaweekwheelwinter
View more matches for 55→"abridging" stat:
Source: Word Database
Legal rate: 230
Rank:
