Gematria Calculation Result for thirteenth on Reverse Extended
The phrase "thirteenth" has a gematria value of 1160 using the Reverse Extended system.
This is calculated by summing each letter's value: t(7) + h(100) + i(90) + r(9) + t(7) + e(400) + e(400) + n(40) + t(7) + h(100).
thirteenth in other Gematria Types:
English Gematria:762
Simple Gematria:127
Jewish Gematria:455
Rabbis (Mispar Gadol):775
Reversed Reduced Gematria:53
Hebrew English Gematria:1485
Reduced Gematria:55
Reversed Simple Gematria:143
Reversed English Gematria:858
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:1
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:477
Reverse Satanic:493
Primes Gematria:400
Reverse Primes:468
Trigonal Gematria:1053
Reverse Trigonal:1277
Squares Gematria:1979
Reverse Squares:2411
Chaldean Numerology:40
Septenary Gematria:54
Single Reduction:55
Full Reduction KV:55
Single Reduction KV:55
Reverse Single Reduction:71
Reverse Full Reduction EP:89
Reverse Single Reduction EP:107
Reverse Extended:1160
Jewish Reduction:50
Jewish Ordinal:122
ALW Kabbalah:179
KFW Kabbalah:131
LCH Kabbalah:97
Fibonacci Sequence:392
Keypad Gematria:55
Matching Word Cloud (Value: 1160)
aflagohoalfamuguisbelbookingbrowsercloselycommuterscompostureconsultercrosstieselbeunuchsfeelfelefleefossettegeldgemmelhegelhygrophyticickeinfinitiveskiddkindlelcdlechlinkedlockemilkmanobtestsone four fouronefourfouroverbusyoverbuysoverwildlyphangphotosynthesespseudoisotropysuppositionarythirteenthtortricestrivialityultrayoungunbrutifyunpropitiatorywilly wonkawillywonkazerocool
View more matches for 1160→"thirteenth" stat:
Source: Word Database
Legal rate: 395
Rank: 1928