Gematria Calculation Result for dag on Reverse Extended
The phrase "dag" has a gematria value of 1500 using the Reverse Extended system.
This is calculated by summing each letter's value: d(500) + a(800) + g(200).
dag in other Gematria Types:
English Gematria:72
Simple Gematria:12
Jewish Gematria:12
Rabbis (Mispar Gadol):12
Reversed Reduced Gematria:15
Hebrew English Gematria:12
Reduced Gematria:12
Reversed Simple Gematria:69
Reversed English Gematria:414
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:500
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:117
Reverse Satanic:174
Primes Gematria:26
Reverse Primes:255
Trigonal Gematria:39
Reverse Trigonal:837
Squares Gematria:66
Reverse Squares:1605
Chaldean Numerology:8
Septenary Gematria:12
Single Reduction:12
Full Reduction KV:12
Single Reduction KV:12
Reverse Single Reduction:15
Reverse Full Reduction EP:15
Reverse Single Reduction EP:15
Reverse Extended:1500
Jewish Reduction:12
Jewish Ordinal:12
ALW Kabbalah:18
KFW Kabbalah:34
LCH Kabbalah:39
Fibonacci Sequence:17
Keypad Gematria:9
Matching Word Cloud (Value: 1500)
abachaffixtagnelaldimangelangleanthelixautoimmunizingbabeebefrizbeowulfcedcelotexchacheeclanclimbcoakcolomboconfineconvertercourantsdagddddecdrawpointebeecheedcedgefaefccgadgalengeedgemmahaffinstaevilkandilayoffslindsaym theory string theorymehmedmoonchildopheliapokimanestubborntrumpflashpool
View more matches for 1500→"dag" stat:
Source: Word Database
Legal rate: 315
Rank: 1072
