Gematria Calculation Result for cursory on Reverse Extended
The phrase "cursory" has a gematria value of 664 using the Reverse Extended system.
This is calculated by summing each letter's value: c(600) + u(6) + r(9) + s(8) + o(30) + r(9) + y(2).
cursory in other Gematria Types:
English Gematria:714
Simple Gematria:119
Jewish Gematria:903
Rabbis (Mispar Gadol):1343
Reversed Reduced Gematria:43
Hebrew English Gematria:779
Reduced Gematria:38
Reversed Simple Gematria:70
Reversed English Gematria:420
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:105
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:364
Reverse Satanic:315
Primes Gematria:411
Reverse Primes:207
Trigonal Gematria:1214
Reverse Trigonal:528
Squares Gematria:2309
Reverse Squares:986
Chaldean Numerology:24
Septenary Gematria:29
Single Reduction:47
Full Reduction KV:38
Single Reduction KV:47
Reverse Single Reduction:43
Reverse Full Reduction EP:43
Reverse Single Reduction EP:43
Reverse Extended:664
Jewish Reduction:39
Jewish Ordinal:111
ALW Kabbalah:81
KFW Kabbalah:89
LCH Kabbalah:98
Fibonacci Sequence:244
Keypad Gematria:46
Matching Word Cloud (Value: 664)
c m x x x vcopuscoupscursorycurvouscutoutselon muskelon musk elonmuskelytroposiseuryzygousgeumsgrosserheliushenhussyhermitsimmunisinginstituteriodouskeyholymississippi isp proxymusk elonodiousointmentpolypodypristineproteolysispurloinerrhemistscumsephirotshrinerssiltierslimnesssmitherspitfrogstyloliteswollenlythermotropythis morningtrophiesusmcvttmzfpkwgvwvipndwelkinwhekiwillemwinklewinniezxlc
View more matches for 664→"cursory" stat:
Source: Word Database
Legal rate: 124
Rank:
