Gematria Calculation Result for times on English Gematria
The phrase "times" has a gematria value of 396 using the English Gematria system.
This is calculated by summing each letter's value: t(120) + i(54) + m(78) + e(30) + s(114).
times in other Gematria Types:
English Gematria:396
Simple Gematria:66
Jewish Gematria:234
Rabbis (Mispar Gadol):354
Reversed Reduced Gematria:33
Hebrew English Gematria:754
Reduced Gematria:21
Reversed Simple Gematria:69
Reversed English Gematria:414
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:1001
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:241
Reverse Satanic:244
Primes Gematria:213
Reverse Primes:219
Trigonal Gematria:551
Reverse Trigonal:593
Squares Gematria:1036
Reverse Squares:1117
Chaldean Numerology:17
Septenary Gematria:24
Single Reduction:30
Full Reduction KV:21
Single Reduction KV:30
Reverse Single Reduction:33
Reverse Full Reduction EP:51
Reverse Single Reduction EP:51
Reverse Extended:555
Jewish Reduction:27
Jewish Ordinal:63
ALW Kabbalah:98
KFW Kabbalah:74
LCH Kabbalah:58
Fibonacci Sequence:306
Keypad Gematria:28
Matching Word Cloud (Value: 396)
abraxasabyssaddendumancientanubisbackdatesblessedbundycatfishcharlesclassiccoreycoronacursedenmarkdialecticenvyeventfamilyfiftyfreedomgrapeshappyjessicalinkablelostlululyonmanuelmolochmortmythonlypixelplannedpopspumpqueerrubyrushseerssinglesnuffsugarthuletimestwinuponweddingwoman
View more matches for 396→"times" stat:
Source: Word Database
Legal rate: 399
Rank: 3080
