Gematria Calculation Result for tithe on Chaldean Numerology
The phrase "tithe" has a gematria value of 19 using the Chaldean Numerology system.
This is calculated by summing each letter's value: t(4) + i(1) + t(4) + h(5) + e(5).
tithe in other Gematria Types:
English Gematria:372
Simple Gematria:62
Jewish Gematria:222
Rabbis (Mispar Gadol):422
Reversed Reduced Gematria:28
Hebrew English Gematria:822
Reduced Gematria:26
Reversed Simple Gematria:73
Reversed English Gematria:438
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:1
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:237
Reverse Satanic:248
Primes Gematria:195
Reverse Primes:241
Trigonal Gematria:516
Reverse Trigonal:670
Squares Gematria:970
Reverse Squares:1267
Chaldean Numerology:19
Septenary Gematria:30
Single Reduction:26
Full Reduction KV:26
Single Reduction KV:26
Reverse Single Reduction:37
Reverse Full Reduction EP:46
Reverse Single Reduction EP:55
Reverse Extended:604
Jewish Reduction:24
Jewish Ordinal:60
ALW Kabbalah:100
KFW Kabbalah:68
LCH Kabbalah:34
Fibonacci Sequence:86
Keypad Gematria:27
Matching Word Cloud (Value: 19)
20canser20canser1361adamiticadonaiaudreyauroraautismbeautybulgariacalvincancerchesscodecookdakotadanieldantedeathdevileightyfaithgeminihollyjumpkevinladderlivedmargaritamayshammiracleneronovaoriginpearlpsalmralphresetsavagesearchsofiฬsomesoulspiritsydneytargettrustvirgowilliamwordwow
View more matches for 19โ"tithe" stat:
Source: Word Database
Legal rate: 183
Rank: 663
