Gematria Calculation Result for chastises on Chaldean Numerology
The phrase "chastises" has a gematria value of 28 using the Chaldean Numerology system.
This is calculated by summing each letter's value: c(3) + h(5) + a(1) + s(3) + t(4) + i(1) + s(3) + e(5) + s(3).
chastises in other Gematria Types:
English Gematria:618
Simple Gematria:103
Jewish Gematria:396
Rabbis (Mispar Gadol):526
Reversed Reduced Gematria:59
Hebrew English Gematria:1326
Reduced Gematria:31
Reversed Simple Gematria:140
Reversed English Gematria:840
Hebrew Gematria:0
Paleo Hebrew Gematria:0
Roman Numeral Gematria:101
Greek Isopsephy:0
Arabic Abjad:0
Satanic Gematria:418
Reverse Satanic:455
Primes Gematria:332
Reverse Primes:471
Trigonal Gematria:883
Reverse Trigonal:1401
Squares Gematria:1663
Reverse Squares:2662
Chaldean Numerology:28
Septenary Gematria:45
Single Reduction:58
Full Reduction KV:31
Single Reduction KV:58
Reverse Single Reduction:68
Reverse Full Reduction EP:77
Reverse Single Reduction EP:86
Reverse Extended:2021
Jewish Reduction:54
Jewish Ordinal:99
ALW Kabbalah:105
KFW Kabbalah:145
LCH Kabbalah:77
Fibonacci Sequence:139
Keypad Gematria:44
Matching Word Cloud (Value: 28)
a satanic markallocableanthonyarchitectballoonbaptisingblackfacechosenchristoscigarettecommandcreationdecodedemonsdivisioneclipseempathyeventsfederalflashbackfrenchfrodogilgameshgooglejuniperkindnesskushnerlucifermigrationnew yorkosmosisplutopopepowerrapturereverseschoolshouldsixteenstatisticalstevenstreamingthe satantranslatetunnelupdatevanguardvulgatewindsorzionist
View more matches for 28→"chastises" stat:
Source: Word Database
Legal rate: 138
Rank:
